PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca48635.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 377aa    MW: 41601.4 Da    PI: 8.5426
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca48635.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.42e-55151431129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeel+++yL kkv + +++  ++i+evd++k+ePw+Lp+k+k +ekewyf+s rd+ky+tg r+nrat++gyWkatgkd+e++s+ +++
  Dca48635.1  15 LPPGFRFHPTDEELITYYLLKKVLDANFTG-RAIAEVDLNKCEPWQLPEKAKMGEKEWYFYSLRDRKYPTGLRTNRATEAGYWKATGKDREIHSSkTNS 112
                 79*************************999.89***************99999****************************************985677 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg+kktLvfy+grapkgek++Wvmheyrle
  Dca48635.1 113 LVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 143
                 7****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6212167IPR003441NAC domain
PROSITE profilePS5100559.42315167IPR003441NAC domain
PfamPF023654.4E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDPFFLHFDN SGTNLPPGFR FHPTDEELIT YYLLKKVLDA NFTGRAIAEV DLNKCEPWQL  60
PEKAKMGEKE WYFYSLRDRK YPTGLRTNRA TEAGYWKATG KDREIHSSKT NSLVGMKKTL  120
VFYRGRAPKG EKSNWVMHEY RLEGKFAYHY LSRTSKDEWV ISRVFQKTGP GAGPTTSTGA  180
TVAPKKARNG MSLYAEVCSS PSSVSQQLPP LLDSSPYGGD CCSFDNVVGD RNTDDSTPIK  240
KEHVSCFSMI NNNNNNSNVV VANNIINPNN NNNNNNNHNN NNLISNFNPF ELTFQPNSRN  300
NNFNMMGLPT FPSLRSLQEN LTLPWVGGPA QMHGGGGFGG GGELGAVLTG WGGGVNNHGG  360
GGRVGGGGSE LDCMWTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-511416716165NO APICAL MERISTEM PROTEIN
1ut4_B2e-511416716165NO APICAL MERISTEM PROTEIN
1ut7_A2e-511416716165NO APICAL MERISTEM PROTEIN
1ut7_B2e-511416716165NO APICAL MERISTEM PROTEIN
3swm_A2e-511416719168NAC domain-containing protein 19
3swm_B2e-511416719168NAC domain-containing protein 19
3swm_C2e-511416719168NAC domain-containing protein 19
3swm_D2e-511416719168NAC domain-containing protein 19
3swp_A2e-511416719168NAC domain-containing protein 19
3swp_B2e-511416719168NAC domain-containing protein 19
3swp_C2e-511416719168NAC domain-containing protein 19
3swp_D2e-511416719168NAC domain-containing protein 19
4dul_A2e-511416716165NAC domain-containing protein 19
4dul_B2e-511416716165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360367GGRVGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675474.11e-151PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotO040171e-105NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A0J8CM761e-151A0A0J8CM76_BETVU; Uncharacterized protein
STRINGSolyc07g062840.2.11e-132(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-101NAC family protein